Structure of PDB 4en2 Chain A Binding Site BS01

Receptor Information
>4en2 Chain A (length=255) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPE
LRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPD
GEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANN
VEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAH
FGLPKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDY
QLRTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4en2 Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef.
Resolution2.58 Å
Binding residue
(original residue number in PDB)
L173 D174 R201 R225 Y384 R393 Y394 L395 K396 L406 P407 W408 V409 R410 I412
Binding residue
(residue number reindexed from 1)
L14 D15 R42 R66 Y216 R225 Y226 L227 K228 L238 P239 W240 V241 R242 I244
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030131 clathrin adaptor complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4en2, PDBe:4en2, PDBj:4en2
PDBsum4en2
PubMed22705789
UniProtP35585|AP1M1_MOUSE AP-1 complex subunit mu-1 (Gene Name=Ap1m1)

[Back to BioLiP]