Structure of PDB 4ejz Chain A Binding Site BS01

Receptor Information
>4ejz Chain A (length=289) Species: 273068 (Caldanaerobacter subterraneus subsp. tengcongensis MB4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRV
VNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEA
IKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYK
GKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKL
HEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHL
YLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ejz Crystal structures of MBOgg1 in complex with two abasic DNA ligands
Resolution3.05 Å
Binding residue
(original residue number in PDB)		Q125 N126 R128 F178 N216 G217 V218 G219 P220 K221 V222 D240 V241 W242
Binding residue
(residue number reindexed from 1)		Q125 N126 R128 F178 N216 G217 V218 G219 P220 K221 V222 D240 V241 W242
Binding affinityPDBbind-CN: Kd=8.2nM
Enzymatic activity
Catalytic site (original residue number in PDB) K221 D240
Catalytic site (residue number reindexed from 1) K221 D240
Enzyme Commision number 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0140097 catalytic activity, acting on DNA
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ejz, PDBe:4ejz, PDBj:4ejz
PDBsum4ejz
PubMed23246782
UniProtQ8R5T9

[Back to BioLiP]