Structure of PDB 4eje Chain A Binding Site BS01

Receptor Information
>4eje Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSREL
MNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKH
VDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>4eje Chain C (length=9) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILPTAPPEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4eje To be published
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y68 N69 M95 F142 S143
Binding residue
(residue number reindexed from 1)		Y66 N67 M93 F140 S141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:4eje, PDBe:4eje, PDBj:4eje
PDBsum4eje
PubMed
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]