Structure of PDB 4edn Chain A Binding Site BS01

Receptor Information
>4edn Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVY
LVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKAR
PEDVVNLDLKSTLRVLYNLFTKYKNVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4edn Structural basis for paxillin binding and focal adhesion targeting of beta-parvin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		A241 K252 V256 S259 Y354 F357 K361
Binding residue
(residue number reindexed from 1)		A4 K15 V19 S22 Y117 F120 K124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007155 cell adhesion
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4edn, PDBe:4edn, PDBj:4edn
PDBsum4edn
PubMed22869380
UniProtQ9HBI1|PARVB_HUMAN Beta-parvin (Gene Name=PARVB)

[Back to BioLiP]