Structure of PDB 4e41 Chain A Binding Site BS01

Receptor Information

>4e41 Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>4e41 Chain C (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GELIGILNAAKVPAD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4e41 Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q9 R50 A52 S53 G58 N62 V65 N69 I72
Binding residue (residue number reindexed from 1)	Q7 R48 A50 S51 G56 N60 V63 N67 I70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4e41, PDBe:4e41, PDBj:4e41
PDBsum	4e41
PubMed
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]