Structure of PDB 4e3b Chain A Binding Site BS01

Receptor Information
>4e3b Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVT
RQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e3b Stereochemical Determinants of C-terminal Specificity in PDZ Peptide-binding Domains: A NOVEL CONTRIBUTION OF THE CARBOXYLATE-BINDING LOOP.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		I29 L30 G31 F32 S33 I34 G35 G36 Q40 Q44 N45 T59 H91
Binding residue
(residue number reindexed from 1)		I18 L19 G20 F21 S22 I23 G24 G25 Q29 Q33 N34 T48 H80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4e3b, PDBe:4e3b, PDBj:4e3b
PDBsum4e3b
PubMed23243314
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]