Structure of PDB 4e17 Chain A Binding Site BS01

Receptor Information
>4e17 Chain A (length=246) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSN
LVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVP
ARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVET
MEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLP
VLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Ligand information
>4e17 Chain B (length=28) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDDRRERIVAECNAVRQALQDLLSEYMG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e17 Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
Resolution2.304 Å
Binding residue
(original residue number in PDB)		T8 I12 V16 Q19 L23 M26 P38 V44 V47 A50 N53 L54 V57 T64 R105 L108 L123 F126 E130
Binding residue
(residue number reindexed from 1)		T10 I14 V18 Q21 L25 M28 P35 V41 V44 A47 N50 L51 V54 T61 R102 L105 L120 F123 E127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4e17, PDBe:4e17, PDBj:4e17
PDBsum4e17
PubMed
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]