Structure of PDB 4dxs Chain A Binding Site BS01

Receptor Information
>4dxs Chain A (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKT
ALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRP
TAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDG
EPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH
Ligand information
>4dxs Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CTQANNFARSFYPMLRYTNGPPPT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dxs LINC Complexes Form by Binding of Three KASH Peptides to Domain Interfaces of Trimeric SUN Proteins.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		T569 T571 L573 L574 S575 L576 F577 G599 A603 S641 Y703 Y707
Binding residue
(residue number reindexed from 1)		T48 T50 L52 L53 S54 L55 F56 G78 A82 S120 Y182 Y186
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4dxs, PDBe:4dxs, PDBj:4dxs
PDBsum4dxs
PubMed22632968
UniProtQ9UH99|SUN2_HUMAN SUN domain-containing protein 2 (Gene Name=SUN2)

[Back to BioLiP]