Structure of PDB 4dow Chain A Binding Site BS01

Receptor Information
>4dow Chain A (length=157) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFSWVGRPLPNRKQFQQMYREICMKINDGSEIHIKVGQFVLIQGEDNKKP
YVAKLIELFQNGAEVPPKKCARVQWFVRFLEIPVSKRHLLGRSPPAQEIF
WYDCSDWDNKINVETIIGPVQVVALAPEEVIPVDQKSEETLFVKLSWNKK
DFAPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dow The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Q55 E57 Y63 W87 E93 S117 D118 W119 D120 E126 T127
Binding residue
(residue number reindexed from 1)		Q43 E45 Y51 W75 E81 S105 D106 W107 D108 E114 T115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:4dow, PDBe:4dow, PDBj:4dow
PDBsum4dow
PubMed22398447
UniProtQ9Z1N2|ORC1_MOUSE Origin recognition complex subunit 1 (Gene Name=Orc1)

[Back to BioLiP]