Structure of PDB 4dk9 Chain A Binding Site BS01

Receptor Information
>4dk9 Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dk9 Crystal Structure of Human Methyl-Binding Domain IV Glycosylase Bound to Abasic DNA.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		R468 M473 P505 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)		R31 M36 P68 G70 L71 Y72 D73 L74
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4dk9, PDBe:4dk9, PDBj:4dk9
PDBsum4dk9
PubMed22560993
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]