Structure of PDB 4dk8 Chain A Binding Site BS01

Receptor Information
>4dk8 Chain A (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQLTAAQELMIQQLVAAQLQCNKRSFSKVTPWPQSRDARQQRFAHFTELA
IISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETE
CITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIA
INIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKL
VSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dk8 Discovery of a new binding mode for a series of liver X receptor agonists.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		D284 K287 R297 E298 I301 K305 E455
Binding residue
(residue number reindexed from 1)		D59 K62 R72 E73 I76 K80 E230
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4dk8, PDBe:4dk8, PDBj:4dk8
PDBsum4dk8
PubMed22406115
UniProtP55055|NR1H2_HUMAN Oxysterols receptor LXR-beta (Gene Name=NR1H2)

[Back to BioLiP]