Structure of PDB 4dk7 Chain A Binding Site BS01

Receptor Information
>4dk7 Chain A (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMQLTAAQELMIQQLVAAQLQCNKRSFSKVTPWPLSRDARQQRFAHFTEL
AIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHET
ECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLI
AINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMK
LVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dk7 Discovery of a new binding mode for a series of liver X receptor agonists.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		K287 R297 E298 I301 K305 P451 L452 E455
Binding residue
(residue number reindexed from 1)		K63 R73 E74 I77 K81 P227 L228 E231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4dk7, PDBe:4dk7, PDBj:4dk7
PDBsum4dk7
PubMed22406115
UniProtP55055|NR1H2_HUMAN Oxysterols receptor LXR-beta (Gene Name=NR1H2)

[Back to BioLiP]