Structure of PDB 4dj9 Chain A Binding Site BS01

Receptor Information
>4dj9 Chain A (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVR
VGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARD
YLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED
LVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLI
SAMKIFVTTQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Ligand information
>4dj9 Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VVLINAVKDVAKALGDLISATK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dj9 Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		I12 Q19 L23 P38 P43 V44 V47 A50 L54 T61 I115 T119 L123 F126
Binding residue
(residue number reindexed from 1)		I10 Q17 L21 P32 P37 V38 V41 A44 L48 T55 I109 T113 L117 F120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dj9, PDBe:4dj9, PDBj:4dj9
PDBsum4dj9
PubMed22334306
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]