Structure of PDB 4dey Chain A Binding Site BS01

Receptor Information
>4dey Chain A (length=281) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGM
AISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQ
RAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISI
TRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKT
SLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELF
DVILDENQLEDACEHLADYLEAYWKATHPPS
Ligand information
>4dey Chain B (length=29) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GDFQKLREKQQLEEDLKGYLDWITQAEDI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dey The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		M245 M246 K248 A249 D252 I344 S346 V349 L353 S356 R357 E389 N390 L392 A395
Binding residue
(residue number reindexed from 1)		M131 M132 K134 A135 D138 I211 S213 V216 L220 S223 R224 E256 N257 L259 A262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005245 voltage-gated calcium channel activity
Biological Process
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005891 voltage-gated calcium channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dey, PDBe:4dey, PDBj:4dey
PDBsum4dey
PubMed22649239
UniProtP54288|CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 (Gene Name=CACNB2)

[Back to BioLiP]