Structure of PDB 4dc2 Chain A Binding Site BS01

Receptor Information
>4dc2 Chain A (length=329) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTE
KHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPE
EHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKE
GLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSP
FDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCH
PQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTN
EPVQLTPDDDDIVRKIDQSEFEGFEYINP
Ligand information
>4dc2 Chain Z (length=16) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PVLAFQREGFGRQSMS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dc2 Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D329 M331 M334 Q335 R338 D368 D372 M389 C404 G405 T406 P407 N408 E435 G439 R440 I445 V446 G447 T456 D543 F546
Binding residue
(residue number reindexed from 1)		D87 M89 M92 Q93 R96 D126 D130 M147 C162 G163 T164 P165 N166 E193 G197 R198 I203 V204 G205 T208 D295 F298
Enzymatic activity
Catalytic site (original residue number in PDB) D368 K370 N373 D386 T406
Catalytic site (residue number reindexed from 1) D126 K128 N131 D144 T164
Enzyme Commision number 2.7.11.13: protein kinase C.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004697 diacylglycerol-dependent serine/threonine kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4dc2, PDBe:4dc2, PDBj:4dc2
PDBsum4dc2
PubMed22579248
UniProtQ62074|KPCI_MOUSE Protein kinase C iota type (Gene Name=Prkci)

[Back to BioLiP]