Structure of PDB 4day Chain A Binding Site BS01

Receptor Information
>4day Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSIT
AKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKC
QRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4day Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		I514 V515 T516 L517 N520 L521 M561 L578 L585 I586
Binding residue
(residue number reindexed from 1)		I33 V34 T35 L36 N39 L40 M80 L97 L104 I105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding

View graph for
Molecular Function
External links
PDB RCSB:4day, PDBe:4day, PDBj:4day
PDBsum4day
PubMed22392978
UniProtQ9H9A7|RMI1_HUMAN RecQ-mediated genome instability protein 1 (Gene Name=RMI1)

[Back to BioLiP]