Structure of PDB 4dav Chain A Binding Site BS01

Receptor Information

>4dav Chain A (length=231) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPG
RIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPEL
EGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPS
VRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKE
ALEAGVEIRALGLHMELSGEIIYRGELGVEI

Ligand information

>4dav Chain X (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgctgtctcgct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4dav The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
Resolution	2.2 Å
Binding residue (original residue number in PDB)	N19 R20 F21 L35 K57 G60 K61 T62
Binding residue (residue number reindexed from 1)	N20 R21 F22 L36 K58 G61 K62 T63

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4dav, PDBe:4dav, PDBj:4dav
PDBsum	4dav
PubMed
UniProt	Q8U1K8\|SFSA_PYRFU Sugar fermentation stimulation protein homolog (Gene Name=sfsA)

[Back to BioLiP]