Structure of PDB 4d8j Chain A Binding Site BS01

Receptor Information
>4d8j Chain A (length=149) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENE
PVLVNGWIDKHMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIV
WQRLAGLAQRRGKTLSETIVQLIEDAENKEKYANKMSSLKQDLQALLGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d8j Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
Resolution3.55 Å
Binding residue
(original residue number in PDB)		K20 K21 Q72 T73 R77 R80 K92 S93 I94 D95
Binding residue
(residue number reindexed from 1)		K20 K21 Q72 T73 R77 R80 K92 S93 I94 D95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007059 chromosome segregation
GO:0051276 chromosome organization
GO:0051289 protein homotetramerization
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm
GO:0097047 DNA replication termination region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d8j, PDBe:4d8j, PDBj:4d8j
PDBsum4d8j
PubMed23084832
UniProtP0A8N0|MATP_ECOLI Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]