Structure of PDB 4d8i Chain A Binding Site BS01

Receptor Information

>4d8i Chain A (length=254) Species: 864568 (Streptococcus pyogenes ATCC 10782)

QPVVKSLLNSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGQHAATGCVAT
ATAQIMKYHNYPNKGLKDYTYTLSSNNPYFNHPKNLFAAISTRQYNWNNI
LPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKEN
FGYNQSVHQINRSDFSKQDWEAQIDKELSQNQPVYYQGVGKVGGHAFVID
GADGRNFYHVNWGWGGVSDGFFRLDALNPSALGTGGGAGGFNGYQSAVVG
IKPL

Ligand information

>4d8i Chain B (length=4)

AEIK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4d8i Ultrahigh and High Resolution Structures and Mutational Analysis of Monomeric Streptococcus pyogenes SpeB Reveal a Functional Role for the Glycine-rich C-terminal Loop.
• Resolution: 1.377 Å
• Binding residue (original residue number in PDB): C192 V193 G281 S282 A283 Q332 G339 H340 A341
• Binding residue (residue number reindexed from 1): C47 V48 G136 S137 A138 Q187 G194 H195 A196

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 22:20:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4d8i', asym_id = 'A', bs = 'BS01', title = 'Ultrahigh and High Resolution Structures and Mut...ional Role for the Glycine-rich C-terminal Loop. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4d8i', asym_id='A', bs='BS01', title='Ultrahigh and High Resolution Structures and Mut...ional Role for the Glycine-rich C-terminal Loop. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006508,0008234', uniprot = '', pdbid = '4d8i', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006508,0008234', uniprot='', pdbid='4d8i', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>