Structure of PDB 4d0b Chain A Binding Site BS01

Receptor Information
>4d0b Chain A (length=276) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWI
AANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCD
ILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDG
DKYQCRVEHASLPQPGLYSWRSGGGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d0b Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y7 I65 S69 I72 N76 L80 W95 H111 F120 T140 W144 Y149 G152 L153 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)
Y7 I65 S69 I72 N76 L80 W95 H111 F120 T140 W144 Y149 G152 L153 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links