Structure of PDB 4cxf Chain A Binding Site BS01

Receptor Information
>4cxf Chain A (length=154) Species: 266264 (Cupriavidus metallidurans CH34) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDT
FVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTL
GKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALL
DADS
Ligand information
>4cxf Chain B (length=29) Species: 266264 (Cupriavidus metallidurans CH34) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADVEEWLTHARKVTQEASIGVDVTSIQEC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cxf The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		Q19 V26 V31 A34 Q35 R38 Q52 F55 R125 E127 T134 A150 I151 R178 S182 L185 D186
Binding residue
(residue number reindexed from 1)		Q15 V22 V27 A30 Q31 R34 Q48 F51 R90 E92 T99 A115 I116 R143 S147 L150 D151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4cxf, PDBe:4cxf, PDBj:4cxf
PDBsum4cxf
PubMed24727125
UniProtP37978|CNRH_CUPMC RNA polymerase sigma factor CnrH (Gene Name=cnrH)

[Back to BioLiP]