Structure of PDB 4cvz Chain A Binding Site BS01

Receptor Information
>4cvz Chain A (length=277) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIA
ANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDI
LEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAE
GLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRA
HGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGD
KYQCRVEHASLPQPGLYSWRSGGGLND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cvz Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		Y7 R9 D24 R61 E62 I65 V66 S69 I72 E75 N76 R83 W95 H111 F120 T140 W144 Y149 G152 L153 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y6 R8 D23 R60 E61 I64 V65 S68 I71 E74 N75 R82 W94 H110 F119 T139 W143 Y148 G151 L152 Y155 W163 Y167
Enzymatic activity
Enzyme Commision number ?
External links