Structure of PDB 4ckt Chain A Binding Site BS01

Receptor Information
>4ckt Chain A (length=127) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAG
FRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIA
REGLEDKYGLQLNPEWRMLKYRSFLGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ckt Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K57 F66 D111 A112 K113 K166 R168
Binding residue
(residue number reindexed from 1)
K11 F20 D65 A66 K67 K120 R122
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4ckt, PDBe:4ckt, PDBj:4ckt
PDBsum4ckt
PubMed24794838
UniProtQ9CQJ2|PIHD1_MOUSE PIH1 domain-containing protein 1 (Gene Name=Pih1d1)

[Back to BioLiP]