Structure of PDB 4cim Chain A Binding Site BS01

Receptor Information
>4cim Chain A (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APDTRALVADFVGYKLRQKGYVSGAGPGEGPAADPLGQALRAIGDEFETR
FRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAAL
CAESVNKEMEPLVGQVQEWMVEYLETRLADWIHSSGGWAEFTALYG
Ligand information
>4cim Chain P (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AADPLGQALRAIGDEFETRFR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cim The Functional Differences of Pro-Survival and Pro-Apoptotic B Cell Lymphoma 2 (Bcl-2) Proteins Depend on Structural Differences in Their Bcl-2 Homology 3 (Bh3) Domains
Resolution1.5 Å
Binding residue
(original residue number in PDB)		I49 E52 F53 R56 F57 F61 R78 V82 E85 L86 N92 W93 G94 R95 Y151
Binding residue
(residue number reindexed from 1)		I43 E46 F47 R50 F51 F55 R72 V76 E79 L80 N86 W87 G88 R89 Y145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4cim, PDBe:4cim, PDBj:4cim
PDBsum4cim
PubMed25371206
UniProtQ92843|B2CL2_HUMAN Bcl-2-like protein 2 (Gene Name=BCL2L2)

[Back to BioLiP]