Structure of PDB 4cic Chain A Binding Site BS01

Receptor Information
>4cic Chain A (length=138) Species: 635013 (Thermincola potens JR) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGLKVSTKGHYGVQAMFDLAQHFGEGPVSLKSIAERQGLSEPYLEQLI
AVLRKAGLVKSVRGAQGGYILAREPRDIKVGDIIRVLEGSLKFDFSVTKS
VWEKVKKSIEEVLDSITLADMLKDAEEAQMAQGYMYYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cic The Unique Regulation of Iron-Sulfur Cluster Biogenesis in a Gram-Positive Bacterium.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		M-1 G0 L1 K2 S4 E84
Binding residue
(residue number reindexed from 1)		M3 G4 L5 K6 S8 E88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cic, PDBe:4cic, PDBj:4cic
PDBsum4cic
PubMed24847070
UniProtD5X843

[Back to BioLiP]