Structure of PDB 4chx Chain A Binding Site BS01

Receptor Information

>4chx Chain A (length=327) Species: 562 (Escherichia coli)

DTNGFDILMGQFAHNIENIWGFKEVVIAGPKDYVKYTDQYQTRSHINFDD
GTITIETIAGTEPAAHLRRAIIKTLLMGDDPSSVDLYSDVDDITISKEPF
LYGQVVDNTGQPIRWEGRASNFADYLLKNRLKSRSNGLRIIYSVTINMVP
NHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTQSSFNPYAVSRSDALG
LMQVVQHTAGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVYL
GGIDNPTSRRYAVITAYNGGAGSVLRVFSNDKIQAANIINTMTPGDVYQT
LTTRHPSAESRRYLYKVNTAQKSYRRR

Ligand information

>4chx Chain C (length=5) Species: 32630 (synthetic construct)

AEKAA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4chx Structure and Cell Wall Cleavage by Modular Lytic Transglycosylase Mltc of Escherichia Coli.
• Resolution: 2.45 Å
• Binding residue (original residue number in PDB): F37 D38 M41 G42 I59 A60 G61 P62
• Binding residue (residue number reindexed from 1): F5 D6 M9 G10 I27 A28 G29 P30

Enzymatic activity

• Enzyme Commision number: 4.2.2.n1: peptidoglycan lytic exotransglycosylase.

Gene Ontology

Molecular Function

• GO:0008932 lytic endotransglycosylase activity
• GO:0008933 lytic transglycosylase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0016829 lyase activity

Biological Process

• GO:0009253 peptidoglycan catabolic process
• GO:0016998 cell wall macromolecule catabolic process
• GO:0034599 cellular response to oxidative stress
• GO:0051301 cell division
• GO:0071236 cellular response to antibiotic
• GO:0071555 cell wall organization

Cellular Component

• GO:0009279 cell outer membrane
• GO:0030288 outer membrane-bounded periplasmic space

External links

• PDB: RCSB:4chx, PDBe:4chx, PDBj:4chx
• PDBsum: 4chx
• PubMed: 24988330
• UniProt: P0C066|MLTC_ECOLI Membrane-bound lytic murein transglycosylase C (Gene Name=mltC)