Structure of PDB 4ch1 Chain A Binding Site BS01

Receptor Information
>4ch1 Chain A (length=97) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQK
SRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ch1 Backbone-Independent Nucleic Acid Binding by Splicing Factor Sup-12 Reveals Key Aspects of Molecular Recognition
ResolutionN/A
Binding residue
(original residue number in PDB)		K36 F38 L42 Y44 V65 I67 G77 Y78 F80 R103 N106 A110 G113 A114 K115
Binding residue
(residue number reindexed from 1)		K12 F14 L18 Y20 V41 I43 G53 Y54 F56 R79 N82 A86 G89 A90 K91
Binding affinityPDBbind-CN: Kd=249nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4ch1, PDBe:4ch1, PDBj:4ch1
PDBsum4ch1
PubMed25183497
UniProtH2L051

[Back to BioLiP]