Structure of PDB 4cc2 Chain A Binding Site BS01

Receptor Information
>4cc2 Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKG
YVPSNYIRKTEYT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc2 Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y1522 N1530 E1531 D1547 V1548 W1554 Y1565 P1567 N1569 Y1570
Binding residue
(residue number reindexed from 1)		Y8 N16 E17 D33 V34 W40 Y51 P53 N55 Y56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cc2, PDBe:4cc2, PDBj:4cc2
PDBsum4cc2
PubMed24332715
UniProtQ6XZF7|DNMBP_HUMAN Dynamin-binding protein (Gene Name=DNMBP)

[Back to BioLiP]