Structure of PDB 4c8z Chain A Binding Site BS01

Receptor Information
>4c8z Chain A (length=238) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLAALVLVLEGEGLPEPLGLRGFFYGLLREVAPEVHDQGENPFALGFGG
REGAAWARVSLLVEGLYARLAPRLYALEGEEVRLGPPFRVRAVLQEGHPW
AGVSTYPRLFQGPPSRDLALRFASPTFFRRKGVHYPVPEPRLVLESLLRR
LEAFGPLKAPEGVREALLERTTVRSLEGRTLPARTEVDTAGFVGRVVYHL
PRATEEEALWLSALGRFAFYSGVGAKTSLGYGRARAES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c8z Evolution of Crispr RNA Recognition and Processing by Cas6 Endonucleases.
Resolution2.503 Å
Binding residue
(original residue number in PDB)		R22 Y26 H37 Q39 G40 F128 R129 R130 V133 H134 L142 E145 R149 E186 V187 D188 A225 K226 S228
Binding residue
(residue number reindexed from 1)		R22 Y26 H37 Q39 G40 F128 R129 R130 V133 H134 L142 E145 R149 E186 V187 D188 A225 K226 S228
Binding affinityPDBbind-CN: Kd=90pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4c8z, PDBe:4c8z, PDBj:4c8z
PDBsum4c8z
PubMed24150936
UniProtQ5SM65

[Back to BioLiP]