Structure of PDB 4c4w Chain A Binding Site BS01

Receptor Information
>4c4w Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
Ligand information
>4c4w Chain D (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagcaagagccauugcacuccgguuugaugaccuc
<<<...<<<<<..........>>>>>......>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c4w Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
Resolution2.95 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 S48 K50 M51 R52 Q54 F56 K80 R83 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 S43 K45 M46 R47 Q49 F51 K75 R78 Q80 A82 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4c4w, PDBe:4c4w, PDBj:4c4w
PDBsum4c4w
PubMed24482444
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]