Structure of PDB 4c3p Chain A Binding Site BS01

Receptor Information

>4c3p Chain A (length=264) Species: 9606 (Homo sapiens)

KRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGV
EHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQK
LSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIAD
FGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLV
GKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPML
REVLEHPWITANSS

Ligand information

>4c3p Chain B (length=17) Species: 9606 (Homo sapiens)

SSYSYDAPSDFINFSSL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4c3p Molecular Mechanism of Aurora a Kinase Autophosphorylation and its Allosteric Activation by Tpx2.
• Resolution: 2.69 Å
• Binding residue (original residue number in PDB): K125 R126 Q127 W128 E152 S155 L159 K166 E170 L178 R179 V182 E183 G198 Y199 H201 V206
• Binding residue (residue number reindexed from 1): K1 R2 Q3 W4 E28 S31 L35 K42 E46 L54 R55 V58 E59 G74 Y75 H77 V82

Enzymatic activity

• Catalytic site (original residue number in PDB): D256 K258 E260 N261 D274 T292
• Catalytic site (residue number reindexed from 1): D132 K134 E136 N137 D150 T168
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0000212 meiotic spindle organization
• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0006468 protein phosphorylation
• GO:0007052 mitotic spindle organization
• GO:0007098 centrosome cycle
• GO:0007100 mitotic centrosome separation
• GO:0051321 meiotic cell cycle

External links

• PDB: RCSB:4c3p, PDBe:4c3p, PDBj:4c3p
• PDBsum: 4c3p
• PubMed: 24867643
• UniProt: O14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)