Structure of PDB 4c0h Chain A Binding Site BS01

Receptor Information
>4c0h Chain A (length=422) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTF
QNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRM
SNFEGPRVVIVGGSQTRKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFT
VPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINEN
KDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHI
IEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLVDDVYKRS
LQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFP
VTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRV
LLPVPGRLPSKAMILTSYRYLE
Ligand information
>4c0h Chain C (length=28) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNSNNIQSRNWYLSDSQWAAFKDDEITS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c0h Structural basis for ATP loss by Clp1p in a G135R mutant protein.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T168 S179 Q191 S192 L193 T194 S195 G196 A197 H201 Q204 M206 K208 V232 R236 L239 Q242 Y332 L341 S342 P343 A345 I388 F390 P404 L406 R422 P426 V427 P428
Binding residue
(residue number reindexed from 1)		T150 S161 Q173 S174 L175 T176 S177 G178 A179 H183 Q186 M188 K190 V214 R218 L221 Q224 Y309 L318 S319 P320 A322 I365 F367 P381 L383 R399 P403 V404 P405
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051731 polynucleotide 5'-hydroxyl-kinase activity
Biological Process
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0031124 mRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005849 mRNA cleavage factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4c0h, PDBe:4c0h, PDBj:4c0h
PDBsum4c0h
PubMed24508575
UniProtQ08685|CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 (Gene Name=CLP1)

[Back to BioLiP]