Structure of PDB 4bxu Chain A Binding Site BS01

Receptor Information
>4bxu Chain A (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMATPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDE
EIDMAFQQSGTAADEPSSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bxu A Novel Pex14 Interacting Site of Human Pex5 is Critical for Matrix Protein Import Into Peroxisomes.
ResolutionN/A
Binding residue
(original residue number in PDB)		T31 F35 R40 V41 S44 P45 T48 R49 F52 K55 K56
Binding residue
(residue number reindexed from 1)		T20 F24 R29 V30 S33 P34 T37 R38 F41 K44 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016560 protein import into peroxisome matrix, docking
Cellular Component
GO:0005778 peroxisomal membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4bxu, PDBe:4bxu, PDBj:4bxu
PDBsum4bxu
PubMed24235149
UniProtO75381|PEX14_HUMAN Peroxisomal membrane protein PEX14 (Gene Name=PEX14)

[Back to BioLiP]