Structure of PDB 4bxr Chain A Binding Site BS01

Receptor Information
>4bxr Chain A (length=183) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSDSKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQ
RVIYYYAEAQTTHITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKT
LHPDGREESVLTDGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGT
VKTVYSDGRQETQYPTGRVRLKDPQGKVIMDTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bxr Crystal structures of the CPAP/STIL complex reveal its role in centriole assembly and human microcephaly.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F959 F978 N980 Y994 Y996 H1003 F1015 E1021
Binding residue
(residue number reindexed from 1)		F19 F38 N40 Y54 Y56 H63 F75 E81
Enzymatic activity
Enzyme Commision number ?
External links