Structure of PDB 4bxl Chain A Binding Site BS01

Receptor Information
>4bxl Chain A (length=46) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK
Ligand information
>4bxl Chain C (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EGVLYVGSKTKEGVVHGVATVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bxl Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.
ResolutionN/A
Binding residue
(original residue number in PDB)		G14 E15 I16 F17 Y18 L19 L27 F30 F31 P38 S41 L45
Binding residue
(residue number reindexed from 1)		G2 E3 I4 F5 Y6 L7 L15 F18 F19 P26 S29 L33
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 17:37:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4bxl', asym_id = 'A', bs = 'BS01', title = 'Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4bxl', asym_id='A', bs='BS01', title='Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0019865', uniprot = '', pdbid = '4bxl', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0019865', uniprot='', pdbid='4bxl', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>