Structure of PDB 4bv0 Chain A Binding Site BS01

Receptor Information

>4bv0 Chain A (length=297) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKSRVDYYLGS
LALSDLLILLFALPVDVYNFIWVHHPWAFGDAGCKGYYFLREACTYATAL
NVVSLSVELYLAIRHPLMSRSRTKKFISAIWLASALLAIPMLFTVGLQNL
SGDGTHPGGLVCTPIVDTATLKVVIQLNTFMSFLFPMLVASILNTVIARR
LTVMVHPGRVQALRRGVLVLRAMVIAFVVCWLPYHVRRLMFVYISDEQWT
TALFDFYHYFYMLSNALVYVSAAINPILYNLVSANFRQVFLSTLACL

Ligand information

>4bv0 Chain C (length=7) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GRRPYIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bv0 Structure of Signaling-Competent Neurotensin Receptor 1 Obtained by Directed Evolution in Escherichia Coli
Resolution	3.1 Å
Binding residue (original residue number in PDB)	D54 L55 D56 H132 Y146 T226 R327 F331 V332 I334 D336 W339 F344 Y347 Y351
Binding residue (residue number reindexed from 1)	D3 L4 D5 H74 Y88 T163 R237 F241 V242 I244 D246 W249 F254 Y257 Y261

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0016492	G protein-coupled neurotensin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bv0, PDBe:4bv0, PDBj:4bv0
PDBsum	4bv0
PubMed	24453215
UniProt	P20789\|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]