Structure of PDB 4btb Chain A Binding Site BS01

Receptor Information

>4btb Chain A (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTS
TATKDPGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFP
NDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGK
VAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLD
KALLLTKKLLELDPEHQRANGNLKYFEYIMA

Ligand information

>4btb Chain C (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPPPPPPPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4btb The Structural Motifs for Substrate Binding and Dimerization of the Alpha Subunit of Collagen Prolyl 4-Hydroxylase
Resolution	1.899 Å
Binding residue (original residue number in PDB)	Y158 Y196 N227 Y230 Y233
Binding residue (residue number reindexed from 1)	Y153 Y191 N222 Y225 Y228

Enzymatic activity

Enzyme Commision number

1.14.11.2: procollagen-proline 4-dioxygenase.

Gene Ontology

	Molecular Function
GO:0004656	procollagen-proline 4-dioxygenase activity

	Cellular Component
GO:0005783	endoplasmic reticulum

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4btb, PDBe:4btb, PDBj:4btb
PDBsum	4btb
PubMed	24207127
UniProt	P13674\|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 (Gene Name=P4HA1)

[Back to BioLiP]