Structure of PDB 4bt9 Chain A Binding Site BS01

Receptor Information

>4bt9 Chain A (length=236) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTST
ATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQ
YFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFE
LGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQG
DLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKE

Ligand information

>4bt9 Chain C (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPGPPGPPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bt9 The Structural Motifs for Substrate Binding and Dimerization of the Alpha Subunit of Collagen Prolyl 4-Hydroxylase
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y158 D192 Y193 Y196 R223 N227 K229 Y230
Binding residue (residue number reindexed from 1)	Y156 D190 Y191 Y194 R221 N225 K227 Y228

Enzymatic activity

Enzyme Commision number

1.14.11.2: procollagen-proline 4-dioxygenase.

Gene Ontology

	Molecular Function
GO:0004656	procollagen-proline 4-dioxygenase activity

	Cellular Component
GO:0005783	endoplasmic reticulum

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4bt9, PDBe:4bt9, PDBj:4bt9
PDBsum	4bt9
PubMed	24207127
UniProt	P13674\|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 (Gene Name=P4HA1)

[Back to BioLiP]