Structure of PDB 4bs2 Chain A Binding Site BS01

Receptor Information
>4bs2 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMASKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSK
GFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFV
GRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCG
EDLIIKGISVHISNAEPKHNSNRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bs2 Molecular Basis of Ug-Rich RNA Recognition by the Human Splicing Factor Tdp-43
ResolutionN/A
Binding residue
(original residue number in PDB)		D105 I107 L109 G110 W113 K136 K145 F147 F149 D174 K176 P178 N179 K181 F194 R197 F221 R227 A228 F229 F231 S254 S258 N259 A260 E261 K263
Binding residue
(residue number reindexed from 1)		D10 I12 L14 G15 W18 K41 K50 F52 F54 D79 K81 P83 N84 K86 F99 R102 F126 R132 A133 F134 F136 S159 S163 N164 A165 E166 K168
Binding affinityPDBbind-CN: Kd=26.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4bs2, PDBe:4bs2, PDBj:4bs2
PDBsum4bs2
PubMed24240615
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]