Structure of PDB 4bqd Chain A Binding Site BS01

Receptor Information
>4bqd Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQC
EEFIYGGCEGNQNRFESLEECKKMCTRD
Ligand information
>4bqd Chain C (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FQSKPNVHVDGYFERLAAKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bqd Small Peptides Blocking Inhibition of Factor Xa and Tissue Factor-Factor Viia by Tissue Factor Pathway Inhibitor (Tfpi)
Resolution2.48 Å
Binding residue
(original residue number in PDB)		T12 T14 A27 F28 K29 A30 D31 D32 A37 I38 F44 N45 I46 F47 I55
Binding residue
(residue number reindexed from 1)		T11 T13 A26 F27 K28 A29 D30 D31 A36 I37 F43 N44 I45 F46 I54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity

View graph for
Molecular Function
External links
PDB RCSB:4bqd, PDBe:4bqd, PDBj:4bqd
PDBsum4bqd
PubMed24275667
UniProtP10646|TFPI1_HUMAN Tissue factor pathway inhibitor (Gene Name=TFPI)

[Back to BioLiP]