Structure of PDB 4bpi Chain A Binding Site BS01

Receptor Information
>4bpi Chain A (length=141) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLYRQSLEIISRYLREQATGSAAGRRALETLRRVGDGVQRNHETAFQGM
LRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTI
NQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bpi Structure-Guided Rational Design of Alpha/Beta-Peptide Foldamers with High Affinity for Bcl-2 Family Prosurvival Proteins.
Resolution1.982 Å
Binding residue
(original residue number in PDB)		H224 F228 M231 V249 H252 V253 D256 N260 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		H43 F47 M50 V68 H71 V72 D75 N79 G81 R82 T85 F137 F138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4bpi, PDBe:4bpi, PDBj:4bpi
PDBsum4bpi
PubMed23929624
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1);
Q07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]