Structure of PDB 4bjt Chain A Binding Site BS01

Receptor Information
>4bjt Chain A (length=152) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVIS
GDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKD
NVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
LL
Ligand information
>4bjt Chain D (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IRIPIFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bjt Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
Resolution1.61 Å
Binding residue
(original residue number in PDB)
P730 A733 T752 G760 D761 L762 D825 L826
Binding residue
(residue number reindexed from 1)
P55 A58 T77 G85 D86 L87 D150 L151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Biological Process
External links
PDB RCSB:4bjt, PDBe:4bjt, PDBj:4bjt
PDBsum4bjt
PubMed23746845
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]