Structure of PDB 4bh7 Chain A Binding Site BS01

Receptor Information

>4bh7 Chain A (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVSLLIYY
GSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGG
GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNEC

Ligand information

>4bh7 Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PYPAWHAP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bh7 Adjustable Locks and Flexible Keys: Plasticity of Epitope-Paratope Interactions in Germline Antibodies.
Resolution	2.89 Å
Binding residue (original residue number in PDB)	Y32 G91 N92 T93 L94 R96
Binding residue (residue number reindexed from 1)	Y32 G91 N92 T93 L94 R96

External links

PDB	RCSB:4bh7, PDBe:4bh7, PDBj:4bh7
PDBsum	4bh7
PubMed	24790145

[Back to BioLiP]