Structure of PDB 4bd6 Chain A Binding Site BS01

Receptor Information
>4bd6 Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGPTSSEQIMKTGALLLQGFIQDRAGRPVPQDASTKKLSESLKRIGDEL
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
Ligand information
>4bd6 Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASTKKLSECLKRIGDELDSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bd6 Bax Crystal Structures Reveal How Bh3 Domains Activate Bax and Nucleate its Oligomerization to Induce Apoptosis.
Resolution2.494 Å
Binding residue
(original residue number in PDB)		L70 L76 M79 R94 D98 M99 N106 G108
Binding residue
(residue number reindexed from 1)		L50 L56 M59 R74 D78 M79 N86 G88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4bd6, PDBe:4bd6, PDBj:4bd6
PDBsum4bd6
PubMed23374347
UniProtQ07812|BAX_HUMAN Apoptosis regulator BAX (Gene Name=BAX)

[Back to BioLiP]