Structure of PDB 4bd3 Chain A Binding Site BS01

Receptor Information
>4bd3 Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDI
QHAGVPGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bd3 Phf19 Links Methylated Lys36 of Histone H3 to Regulation of Polycomb Activity
ResolutionN/A
Binding residue
(original residue number in PDB)
L47 G53 L54 Y55 Y56 E75 D76 V92 G94
Binding residue
(residue number reindexed from 1)
L10 G16 L17 Y18 Y19 E38 D39 V55 G57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4bd3, PDBe:4bd3, PDBj:4bd3
PDBsum4bd3
PubMed23104054
UniProtQ5T6S3|PHF19_HUMAN PHD finger protein 19 (Gene Name=PHF19)

[Back to BioLiP]