Structure of PDB 4b9w Chain A Binding Site BS01

Receptor Information
>4b9w Chain A (length=196) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADY
CAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGN
VEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACV
VGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b9w The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
M716 M717 Y718 E722 F767 Y774 F791 Y794 N796 K836 T839 Q843
Binding residue
(residue number reindexed from 1)
M20 M21 Y22 E26 F71 Y78 F95 Y98 N100 K140 T143 Q147
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4b9w, PDBe:4b9w, PDBj:4b9w
PDBsum4b9w
PubMed22996915
UniProtQ99MV1|TDRD1_MOUSE Tudor domain-containing protein 1 (Gene Name=Tdrd1)

[Back to BioLiP]