Structure of PDB 4b8y Chain A Binding Site BS01

Receptor Information

>4b8y Chain A (length=277) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGGLKKLGANIVAVNQQV
DQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQKVAPT
VVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIG
QDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGW
AEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDA
GTYWYNDPYTLDFMRKDLKEKLIKAAK

Ligand information

>4b8y Chain B (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GGGAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4b8y Structural and Functional Characterization of the Staphylococcus Aureus Virulence Factor and Vaccine Candidate Fhud2.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y110 T112 Y130 F186 Y191 W197 R199 W225 W279
Binding residue (residue number reindexed from 1)	Y85 T87 Y105 F161 Y166 W172 R174 W200 W254

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0030288	outer membrane-bounded periplasmic space

View graph for
Cellular Component

External links

PDB	RCSB:4b8y, PDBe:4b8y, PDBj:4b8y
PDBsum	4b8y
PubMed	23113737
UniProt	Q2FVW9

[Back to BioLiP]