Structure of PDB 4b8t Chain A Binding Site BS01

Receptor Information
>4b8t Chain A (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMAYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDD
GTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRG
RGRGQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b8t Noncanonical G Recognition Mediates Ksrp Regulation of Let-7 Biogenesis
ResolutionN/A
Binding residue
(original residue number in PDB)		R19 H20 V22 G23 V24 I26 R28 G30 Q37 I44 F46
Binding residue
(residue number reindexed from 1)		R19 H20 V22 G23 V24 I26 R28 G30 Q37 I44 F46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4b8t, PDBe:4b8t, PDBj:4b8t
PDBsum4b8t
PubMed23142982
UniProtQ92945|FUBP2_HUMAN Far upstream element-binding protein 2 (Gene Name=KHSRP)

[Back to BioLiP]