Structure of PDB 4b4n Chain A Binding Site BS01

Receptor Information

>4b4n Chain A (length=136) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVREPRGSDIAGTTST
LQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS

Ligand information

>4b4n Chain B (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPPLG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4b4n Cpsf6 Defines a Conserved Capsid Interface that Modulates HIV-1 Replication.
Resolution	1.813 Å
Binding residue (original residue number in PDB)	N53 L56 N57 Q67 K70 N74 T107
Binding residue (residue number reindexed from 1)	N53 L56 N57 Q67 K70 N74 T97

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:4b4n, PDBe:4b4n, PDBj:4b4n
PDBsum	4b4n
PubMed	22956906
UniProt	A9PKC6

[Back to BioLiP]