Structure of PDB 4b24 Chain A Binding Site BS01

Receptor Information
>4b24 Chain A (length=206) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQ
KLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQE
IHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTL
GRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYL
WQIPKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b24 Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q52 K53 L98 E102 K137 G138 K140 W142 T143 L208
Binding residue
(residue number reindexed from 1)		Q50 K51 L96 E100 K135 G136 K138 W140 T141 L206
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0032131 alkylated DNA binding
GO:0140431 DNA-(abasic site) binding
Biological Process
GO:0000725 recombinational repair
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006285 base-excision repair, AP site formation
GO:0006289 nucleotide-excision repair
GO:0006307 DNA alkylation repair
Cellular Component
GO:0005634 nucleus
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b24, PDBe:4b24, PDBj:4b24
PDBsum4b24
PubMed23245849
UniProtO94468|MAG2_SCHPO Alkylbase DNA glycosidase-like protein mag2 (Gene Name=mag2)

[Back to BioLiP]